PDB entry 1nqn

View 1nqn on RCSB PDB site
Description: Structure of Avm-W110K (W110K mutant of avidin)
Class: unknown function
Keywords: avidin, streptavidin, biotin, monomer-monomer interaction, UNKNOWN FUNCTION
Deposited on 2003-01-22, released 2003-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Gene: AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • see remark 999 (32)
      • engineered (108)
    Domains in SCOPe 2.05: d1nqna_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Gene: AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-121)
      • see remark 999 (32)
      • engineered (108)
    Domains in SCOPe 2.05: d1nqnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nqnA (A:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddkkatrvginift
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nqnA (A:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavneikesplhgtentinkrtqptfg
    ftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddkkatrvginiftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nqnB (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddkkatrvginift
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nqnB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttkesplhgtentinkrtqptfgftvnwk
    fsesttvftgqcfidngkevlktmwllrssvndigddkkatrvginiftrl