PDB entry 1nqn

View 1nqn on RCSB PDB site
Description: structure of avm-w110k (w110k mutant of avidin)
Deposited on 2003-01-22, released 2003-07-15
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-22, with a file datestamp of 2003-07-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1nqna_
  • Chain 'B':
    Domains in SCOP 1.71: d1nqnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nqnA (A:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddkkatrvginift
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nqnA (A:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavneikesplhgtentinkrtqptfg
    ftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddkkatrvginiftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nqnB (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddkkatrvginift
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nqnB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttkesplhgtentinkrtqptfgftvnwk
    fsesttvftgqcfidngkevlktmwllrssvndigddkkatrvginiftrl