PDB entry 1nqf

View 1nqf on RCSB PDB site
Description: outer membrane cobalamin transporter (btub) from e. coli, methionine substiution construct for se-met sad phasing
Class: transport protein
Keywords: BETA BARREL, cobalamin, VITAMIN B12, OUTER MEMBRANE TRANSPORT, TRANSPORT PROTEIN
Deposited on 2003-01-21, released 2003-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin B12 receptor
    Species: Escherichia coli [TaxId:562]
    Gene: btuB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06129 (Start-593)
      • engineered (292)
      • engineered (316)
      • engineered (318)
      • engineered (320)
      • engineered (515)
      • engineered (517)
      • engineered (519)
      • engineered (540)
    Domains in SCOPe 2.08: d1nqfa_
  • Heterogens: MG, C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nqfA (A:)
    qdtspdtlvvtanrfeqprstvlapttvvtrqdidrwqstsvndvlrrlpgvditqnggs
    gqlssifirgtnashvlvlidgvrlnlagvsgsadlsqfpialvqrveyirgprsavygs
    daiggvvniittrdepgteisagwgsnsyqnydvstqqqlgdktrvtllgdyahthgydv
    vaygntgtqaqtdndgflsktlygalehnftdawsgfvrgygydnrtnydayyspgspll
    dtrklysqswdaglryngeliksqlitsyshskdynydphygrydssatldemkqytvqw
    annvivghgsigagvdmqmqmttpgtgyvedgydqrntgiyltglqqvgdftfegaarsd
    dnsqfgrhgtwqtsagwefiegyrfiasygtsykapnlgqlygfygnpnldpekskqweg
    afegltagvnwrisgyrndvsdlidyddhtlkyynegkarikgveatanfdtgplthtvs
    ydyvdarnaitdtpllrrakqqvkyqldwqlydfdmgmtmqylgtrydkdyssypyqtvk
    mggvslwdlavaypvtshltvrgkianlfdkdyetvygyqtagreytlsgsytf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nqfA (A:)
    tlvvtanrfeqprstvlapttvvtrqdidrwqstsvndvlrrlpgvditqnggsgqlssi
    firgtnashvlvlidgvrlnlagvsgsadlsqfpialvqrveyirgprsavygsdaiggv
    vniittrdepgteisagwgsnsyqnydvstqqqlgdktrvtllgdyahthgflsktlyga
    lehnftdawsgfvrgygydnrtndtrklysqswdaglryngeliksqlitsyshskdyny
    atldemkqytvqwannvivghgsigagvdmqmqmttpgtgdgydqrntgiyltglqqvgd
    ftfegaarsddnsqfgrhgtwqtsagwefiegyrfiasygtsykapnlgqlygfygnpnl
    dpekskqwegafegltagvnwrisgyrndvsdlidyddhtlkyynegkarikgveatanf
    dtgplthtvsydyvdarnaitdtpllrrakqqvkyqldwqlydfdmgmtmqylgtrydkd
    yssypyqtvkmggvslwdlavaypvtshltvrgkianlfdkdyetvygyqtagreytlsg
    sytf