PDB entry 1nqb

View 1nqb on RCSB PDB site
Description: trivalent antibody fragment
Deposited on 1997-04-04, released 1997-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqbA (A:)
    vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtkyn
    ekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvssd
    ieltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrfs
    gvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqbC (C:)
    vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtkyn
    ekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvssd
    ieltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrfs
    gvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr