PDB entry 1nqa

View 1nqa on RCSB PDB site
Description: Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ and D-Glyceraldehyde-3-Phosphate
Class: Oxidoreductase
Keywords: Glycolysis, Oxidoreductase, NAD
Deposited on 2003-01-21, released 2003-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.07: d1nqao1, d1nqao2
  • Chain 'P':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.07: d1nqap1, d1nqap2
  • Chain 'Q':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.07: d1nqaq1, d1nqaq2
  • Chain 'R':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.07: d1nqar1, d1nqar2
  • Heterogens: NAD, G3H, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqaO (O:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnasattnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqaP (P:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnasattnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqaQ (Q:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnasattnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqaR (R:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnasattnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl