PDB entry 1nq5

View 1nq5 on RCSB PDB site
Description: Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+
Deposited on 2003-01-21, released 2003-04-22
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-22, with a file datestamp of 2003-04-22.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nq5A (A:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnassttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nq5C (C:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnassttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nq5O (O:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnassttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nq5Q (Q:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnassttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl