PDB entry 1nq5

View 1nq5 on RCSB PDB site
Description: Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+
Class: Oxidoreductase
Keywords: Glycolysis, Oxidoreductase, NAD
Deposited on 2003-01-21, released 2003-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.07: d1nq5a1, d1nq5a2
  • Chain 'C':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.07: d1nq5c1, d1nq5c2
  • Chain 'O':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.07: d1nq5o1, d1nq5o2
  • Chain 'Q':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.07: d1nq5q1, d1nq5q2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nq5A (A:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnassttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nq5C (C:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnassttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nq5O (O:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnassttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nq5Q (Q:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnassttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl