PDB entry 1nq4

View 1nq4 on RCSB PDB site
Description: Solution Structure of Oxytetracycline Acyl Carrier Protein
Class: biosynthetic protein
Keywords: NMR, solution structure, oxytetracycline, polyketide synthase, dynamics, ACP, BIOSYNTHETIC PROTEIN
Deposited on 2003-01-21, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Oxytetracycline polyketide synthase acyl carrier protein
  Species: Streptomyces rimosus [TaxId:1927]
  Gene: otcY1-3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43677 (0-94)
  Domains in SCOPe 2.08: d1nq4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nq4A (A:)
  mtlltlsdlltllrecageeesidlggdvedvafdalgydslallntvgrierdygvqlg
  ddavekattpraliemtnasltgaspsaggaardk