PDB entry 1nq3

View 1nq3 on RCSB PDB site
Description: Crystal structure of the mammalian tumor associated antigen UK114
Class: Immune system, metal binding protein
Keywords: tumor associated antigen, YER057c/YIL051c/YjgF protein family, UK114, crystal structure, trimer, Immune system, metal binding protein
Deposited on 2003-01-21, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14.3 kDa perchloric acid soluble protein
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nq3a_
  • Chain 'B':
    Compound: 14.3 kDa perchloric acid soluble protein
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nq3b_
  • Chain 'C':
    Compound: 14.3 kDa perchloric acid soluble protein
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nq3c_
  • Chain 'D':
    Compound: 14.3 kDa perchloric acid soluble protein
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nq3d_
  • Chain 'E':
    Compound: 14.3 kDa perchloric acid soluble protein
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nq3e_
  • Chain 'F':
    Compound: 14.3 kDa perchloric acid soluble protein
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nq3f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nq3A (A:)
    sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
    igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
    eieaiavqgplttasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nq3A (A:)
    slvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltni
    geilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrve
    ieaiavqgpltta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nq3B (B:)
    sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
    igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
    eieaiavqgplttasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nq3B (B:)
    slvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltni
    geilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrve
    ieaiavqgpltta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nq3C (C:)
    sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
    igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
    eieaiavqgplttasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nq3C (C:)
    sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
    igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
    eieaiavqgpltt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nq3D (D:)
    sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
    igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
    eieaiavqgplttasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nq3D (D:)
    slvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltni
    geilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrve
    ieaiavqgpltt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nq3E (E:)
    sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
    igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
    eieaiavqgplttasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nq3E (E:)
    sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
    igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
    eieaiavqgpltt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nq3F (F:)
    sslvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltn
    igeilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrv
    eieaiavqgplttasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nq3F (F:)
    slvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltni
    geilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrve
    ieaiavqgpltta