PDB entry 1npx

View 1npx on RCSB PDB site
Description: structure of nadh peroxidase from streptococcus faecalis 10c1 refined at 2.16 angstroms resolution
Deposited on 1991-08-02, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.16 Å
R-factor: 0.177
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1npx_ (-)
    mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
    mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldi
    pgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvidi
    ldrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvvv
    avgvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialat
    narkqgrfavknleepvkpfpgvqgssglavfdykfastginevmaqklgketkavtvve
    dylmdfnpdkqkawfklvydpettqilgaqlmskadltaninaislaiqakmtiedlaya
    dfffqpafdkpwniintaaleavkqer