PDB entry 1npu

View 1npu on RCSB PDB site
Description: crystal structure of the extracellular domain of murine pd-1
Class: immune system
Keywords: Ig V-type domain, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, IMMUNE SYSTEM
Deposited on 2003-01-20, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: PDCD1 OR PD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02242 (0-End)
      • engineered (49)
    Domains in SCOPe 2.07: d1npua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1npuA (A:)
    sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
    rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvterile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1npuA (A:)
    sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
    rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvteril