PDB entry 1npt

View 1npt on RCSB PDB site
Description: Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 replaced by Ala complexed with NAD+
Class: oxidoreductase
Keywords: glycolysis, Oxidoreductase, NAD
Deposited on 2003-01-20, released 2003-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.177
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.06: d1npto1, d1npto2
  • Chain 'P':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.06: d1nptp1, d1nptp2
  • Chain 'Q':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.06: d1nptq1, d1nptq2
  • Chain 'R':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (150)
    Domains in SCOPe 2.06: d1nptr1, d1nptr2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nptO (O:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnasattnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nptP (P:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnasattnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nptQ (Q:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnasattnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nptR (R:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnasattnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl