PDB entry 1nps

View 1nps on RCSB PDB site
Description: crystal structure of n-terminal domain of protein s
Class: signaling protein
Keywords: crystalline like structure, signaling protein
Deposited on 1999-02-01, released 2000-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.25
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: development-specific protein s
  Species: MYXOCOCCUS XANTHUS [TaxId:34]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02966 (0-87)
  Domains in SCOPe 2.08: d1npsa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1npsA (A:)
  anitvfynedfqgkqvdlppgnytraqlaalgienntissvkvppgvkailyqndgfagd
  qievvanaeelgplnnnvssirvisvpv