PDB entry 1npq

View 1npq on RCSB PDB site
Description: structure of a rhodamine-labeled n-domain troponin c mutant (ca2+ saturated) in complex with skeletal troponin i 115-131
Deposited on 2003-01-18, released 2003-04-29
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-29, with a file datestamp of 2003-04-29.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1npqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1npqA (A:)
  asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkcelda
  iicevdedgsgtidfeeflvmmvrqmkeda