PDB entry 1npq

View 1npq on RCSB PDB site
Description: structure of a rhodamine-labeled N-domain Troponin C mutant (Ca2+ saturated) in complex with skeletal Troponin I 115-131
Class: structural protein
Keywords: Troponin C- Troponin I complex, bifunctional rhodamine labeled Toponin C, STRUCTURAL PROTEIN
Deposited on 2003-01-18, released 2003-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Gene: TNNC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02588 (0-89)
      • engineered (55)
      • engineered (62)
    Domains in SCOPe 2.07: d1npqa_
  • Chain 'B':
    Compound: troponin I
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1npqA (A:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkcelda
    iicevdedgsgtidfeeflvmmvrqmkeda
    

  • Chain 'B':
    No sequence available.