PDB entry 1npo

View 1npo on RCSB PDB site
Description: bovine neurophysin II complex with oxytocin
Class: complex (hormone transport/hormone)
Keywords: complex (hormone transport/hormone), hypothalamus
Deposited on 1996-02-01, released 1997-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.182
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neurophysin II
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1npoa_
  • Chain 'B':
    Compound: oxytocin
    Database cross-references and differences (RAF-indexed):
    • PDB 1NPO (0-8)
  • Chain 'C':
    Compound: neurophysin II
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01180
      • conflict (17)
    Domains in SCOPe 2.08: d1npoc_
  • Chain 'D':
    Compound: oxytocin
    Database cross-references and differences (RAF-indexed):
    • PDB 1NPO (0-8)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1npoA (A:)
amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccndescvtepecregvgfprrv

    Sequence, based on observed residues (ATOM records): (download) 
    >1npoA (A:)
lelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsg
grcaaagiccndescvtepec

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1npoC (C:)
amsdlelrqclpcgpggagrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccndescvtepecregvgfprrv

    Sequence, based on observed residues (ATOM records): (download) 
    >1npoC (C:)
lrqclpcgpggagrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccndescvtepec

  • Chain 'D':
    No sequence available.