PDB entry 1npl

View 1npl on RCSB PDB site
Description: mannose-specific agglutinin (lectin) from daffodil (narcissus pseudonarcissus) bulbs in complex with mannose-alpha1,3-mannose
Class: sugar binding protein
Keywords: lectin, agglutinin, mannobiose, mannose-alpha1, 3-mannose, daffodil, sugar binding protein
Deposited on 1998-12-17, released 1998-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (agglutinin)
  Species: Narcissus pseudonarcissus [TaxId:39639]
  Database cross-references and differences (RAF-indexed):
  • GB L16511 (0-108)
    • conflict (14)
    • conflict (16-17)
    • conflict (26)
    • conflict (34)
    • conflict (47-50)
    • conflict (57)
    • conflict (66-67)
  Domains in SCOPe 2.08: d1npla_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nplA (A:)
  dnilysgetlspgeflnngryvfimqedcnlvlydvdkpiwatntggldrrchlsmqsdg
  nlvvysprnnpiwasntggengnyvcvlqkdrnvviygtarwatgtnih