PDB entry 1npk

View 1npk on RCSB PDB site
Description: refined x-ray structure of dictyostelium nucleoside diphosphate kinase at 1,8 angstroms resolution
Class: phosphotransferase(po4 as acceptor)
Keywords: phosphotransferase(po4 as acceptor)
Deposited on 1994-07-27, released 1994-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1npka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1npkA (A:)
    stnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehke
    rpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrnii
    hgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1npkA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye