PDB entry 1npe

View 1npe on RCSB PDB site
Description: Crystal structure of Nidogen/Laminin Complex
Class: structural protein
Keywords: Glycoprotein, Basement membrane, beta-propeller, EGF-like, STRUCTURAL PROTEIN
Deposited on 2003-01-17, released 2003-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nidogen
    Species: Mus musculus [TaxId:10090]
    Gene: NID or NID1 or ENT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1npea_
  • Chain 'B':
    Compound: Laminin gamma-1 chain
    Species: Mus musculus [TaxId:10090]
    Gene: LAMC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1npeb1, d1npeb2, d1npeb3
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1npeA (A:)
    gthllfaqtgkierlplerntmkkteakaflhipakviiglafdcvdkvvywtdisepsi
    graslhggepttiirqdlgspegialdhlgrtifwtdsqldrievakmdgtqrrvlfdtg
    lvnprgivtdpvrgnlywtdwnrdnpkietshmdgtnrrilaqdnlglpngltfdafssq
    lcwvdagthraeclnpaqpgrrkvleglqypfavtsygknlyytdwktnsviamdlaisk
    emdtfhphkqtrlygitialsqcpqgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1npeA (A:)
    gthllfaqtgkierlplerntmkkteakaflhipakviiglafdcvdkvvywtdisepsi
    graslhggepttiirqdlgspegialdhlgrtifwtdsqldrievakmdgtqrrvlfdtg
    lvnprgivtdpvrgnlywtdwnrdnpkietshmdgtnrrilaqdnlglpngltfdafssq
    lcwvdagthraeclnpaqpgrrkvleglqypfavtsygknlyytdwktnsviamdlaisk
    emdtfhphkqtrlygitialsqc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1npeB (B:)
    qpcpcpggsscaivpktkevvcthcptgtagkrcelcddgyfgdplgsngpvrlcrpcqc
    ndnidpnavgncnrltgeclkciyntagfycdrckegffgnplapnpadkckacacnpyg
    tvqqqsscnpvtgqcqclphvsgrdcgtcdpgyynlqsgqgcer