PDB entry 1npe

View 1npe on RCSB PDB site
Description: Crystal structure of Nidogen/Laminin Complex
Deposited on 2003-01-17, released 2003-08-12
The last revision prior to the SCOP 1.71 freeze date was dated 2003-08-12, with a file datestamp of 2003-08-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1npeA (A:)
    gthllfaqtgkierlplerntmkkteakaflhipakviiglafdcvdkvvywtdisepsi
    graslhggepttiirqdlgspegialdhlgrtifwtdsqldrievakmdgtqrrvlfdtg
    lvnprgivtdpvrgnlywtdwnrdnpkietshmdgtnrrilaqdnlglpngltfdafssq
    lcwvdagthraeclnpaqpgrrkvleglqypfavtsygknlyytdwktnsviamdlaisk
    emdtfhphkqtrlygitialsqcpqgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1npeA (A:)
    gthllfaqtgkierlplerntmkkteakaflhipakviiglafdcvdkvvywtdisepsi
    graslhggepttiirqdlgspegialdhlgrtifwtdsqldrievakmdgtqrrvlfdtg
    lvnprgivtdpvrgnlywtdwnrdnpkietshmdgtnrrilaqdnlglpngltfdafssq
    lcwvdagthraeclnpaqpgrrkvleglqypfavtsygknlyytdwktnsviamdlaisk
    emdtfhphkqtrlygitialsqc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1npeB (B:)
    qpcpcpggsscaivpktkevvcthcptgtagkrcelcddgyfgdplgsngpvrlcrpcqc
    ndnidpnavgncnrltgeclkciyntagfycdrckegffgnplapnpadkckacacnpyg
    tvqqqsscnpvtgqcqclphvsgrdcgtcdpgyynlqsgqgcer