PDB entry 1npd

View 1npd on RCSB PDB site
Description: x-ray structure of shikimate dehydrogenase complexed with nad+ from e.coli (ydib) northeast structural genomics research consortium (nesg) target er24
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2003-01-17, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical shikimate 5-dehydrogenase-like protein ydib
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6D5 (0-End)
      • modified residue (0)
      • modified residue (12)
      • modified residue (24)
      • modified residue (39)
      • modified residue (60)
      • modified residue (67)
      • modified residue (126)
      • modified residue (207)
      • modified residue (237)
      • modified residue (257)
      • modified residue (283)
    Domains in SCOPe 2.07: d1npda1, d1npda2
  • Chain 'B':
    Compound: hypothetical shikimate 5-dehydrogenase-like protein ydib
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6D5 (0-287)
      • modified residue (0)
      • modified residue (12)
      • modified residue (24)
      • modified residue (39)
      • modified residue (60)
      • modified residue (67)
      • modified residue (126)
      • modified residue (207)
      • modified residue (237)
      • modified residue (257)
      • modified residue (283)
    Domains in SCOPe 2.07: d1npdb1, d1npdb2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1npdA (A:)
    mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
    mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgf
    dikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvt
    vtdladqqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtk
    llqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1npdA (A:)
    mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
    mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgf
    dikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvt
    vtdladqqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtk
    llqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1npdB (B:)
    mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
    mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgf
    dikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvt
    vtdladqqafaealasadiltngtkvgmkpleneslvndisllhpgllvtecvynphmtk
    llqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgfga