PDB entry 1np7

View 1np7 on RCSB PDB site
Description: Crystal Structure Analysis of Synechocystis sp. PCC6803 cryptochrome
Class: lyase
Keywords: protein with FAD cofactor, LYASE
Deposited on 2003-01-17, released 2003-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA photolyase
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77967 (37-End)
      • conflict (0-36)
    Domains in SCOPe 2.06: d1np7a1, d1np7a2
  • Chain 'B':
    Compound: DNA photolyase
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77967 (37-End)
      • conflict (0-36)
    Domains in SCOPe 2.06: d1np7b1, d1np7b2
  • Heterogens: SO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1np7A (A:)
    mkhvpptvlvwfrndlrlhdheplhralksglaitavycydprqfaqthqgfaktgpwrs
    nflqqsvqnlaeslqkvgnkllvttglpeqvipqiakqinaktiyyhrevtqeeldvern
    lvkqltilgieakgywgstlchpedlpfsiqdlpdlftkfrkdiekkkisirpcffapsq
    llpspnikleltapppeffpqinfdhrsvlafqggetaglarlqdyfwhgdrlkdyketr
    ngmvgadysskfspwlalgclsprfiyqevkryeqervsndsthwlifellwrdffrfva
    qkygnklfnrggllnknfpwqedqvrfelwrsgqtgyplvdanmrelnltgfmsnrgrqn
    vasflcknlgidwrwgaewfesclidydvcsnwgnwnytagigndardfryfnipkqsqq
    ydpqgtylrhwlpelknlpgdkihqpwllsateqkqwgvqlgvdyprpcvnfhqsvearr
    kieqmgvia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1np7A (A:)
    mkhvpptvlvwfrndlrlhdheplhralksglaitavycydprqfaqthqgfaktgpwrs
    nflqqsvqnlaeslqkvgnkllvttglpeqvipqiakqinaktiyyhrevtqeeldvern
    lvkqltilgieakgywgstlchpedlpfsiqdlpdlftkfrkdiekkkisirpcffapsq
    llpspnikleltapppeffpqinfdhrsvlafqggetaglarlqdyfwhgdrlkdyketr
    ngmvgadysskfspwlalgclsprfiyqevkryeqervsndsthwlifellwrdffrfva
    qkygnklfnrggllnknfpwqedqvrfelwrsgqtgyplvdanmrelnltgfmsnrgrqn
    vasflcknlgidwrwgaewfesclidydvcsnwgnwnytagigndardfryfnipkqsqq
    ydpqgtylrhwlpelknlpgdkihqpwllsateqkqwgvqlgvdyprpcvnfhqsvearr
    kie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1np7B (B:)
    mkhvpptvlvwfrndlrlhdheplhralksglaitavycydprqfaqthqgfaktgpwrs
    nflqqsvqnlaeslqkvgnkllvttglpeqvipqiakqinaktiyyhrevtqeeldvern
    lvkqltilgieakgywgstlchpedlpfsiqdlpdlftkfrkdiekkkisirpcffapsq
    llpspnikleltapppeffpqinfdhrsvlafqggetaglarlqdyfwhgdrlkdyketr
    ngmvgadysskfspwlalgclsprfiyqevkryeqervsndsthwlifellwrdffrfva
    qkygnklfnrggllnknfpwqedqvrfelwrsgqtgyplvdanmrelnltgfmsnrgrqn
    vasflcknlgidwrwgaewfesclidydvcsnwgnwnytagigndardfryfnipkqsqq
    ydpqgtylrhwlpelknlpgdkihqpwllsateqkqwgvqlgvdyprpcvnfhqsvearr
    kieqmgvia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1np7B (B:)
    mkhvpptvlvwfrndlrlhdheplhralksglaitavycydprqfaqthqgfaktgpwrs
    nflqqsvqnlaeslqkvgnkllvttglpeqvipqiakqinaktiyyhrevtqeeldvern
    lvkqltilgieakgywgstlchpedlpfsiqdlpdlftkfrkdiekkkisirpcffapsq
    llpspnikleltapppeffpqinfdhrsvlafqggetaglarlqdyfwhgdrlkdyketr
    ngmvgadysskfspwlalgclsprfiyqevkryeqervsndsthwlifellwrdffrfva
    qkygnklfnrggllnknfpwqedqvrfelwrsgqtgyplvdanmrelnltgfmsnrgrqn
    vasflcknlgidwrwgaewfesclidydvcsnwgnwnytagigndardfryfnipkqsqq
    ydpqgtylrhwlpelknlpgdkihqpwllsateqkqwgvqlgvdyprpcvnfhqsvearr
    kie