PDB entry 1np3

View 1np3 on RCSB PDB site
Description: Crystal structure of class I acetohydroxy acid isomeroreductase from Pseudomonas aeruginosa
Class: oxidoreductase
Keywords: a deep figure-of-eight knot, C-terminal alpha-helical domain
Deposited on 2003-01-17, released 2003-05-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-05-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketol-acid reductoisomerase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1np3a1, d1np3a2
  • Chain 'B':
    Compound: Ketol-acid reductoisomerase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1np3b1, d1np3b2
  • Chain 'C':
    Compound: Ketol-acid reductoisomerase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1np3c1, d1np3c2
  • Chain 'D':
    Compound: Ketol-acid reductoisomerase
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1np3d1, d1np3d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1np3A (A:)
    mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
    lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmye
    ggianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahpieqigeklrammpwiaankivdkskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1np3A (A:)
    mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
    lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmye
    ggianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahpieqigeklrammpwi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1np3B (B:)
    mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
    lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmye
    ggianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahpieqigeklrammpwiaankivdkskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1np3B (B:)
    mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
    lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmye
    ggianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahpieqigeklrammpwi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1np3C (C:)
    mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
    lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmye
    ggianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahpieqigeklrammpwiaankivdkskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1np3C (C:)
    mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
    lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmye
    ggianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahpieqigeklrammpwi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1np3D (D:)
    mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
    lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmye
    ggianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahpieqigeklrammpwiaankivdkskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1np3D (D:)
    mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
    lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmye
    ggianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahpieqigeklrammpwi