PDB entry 1nou

View 1nou on RCSB PDB site
Description: Native human lysosomal beta-hexosaminidase isoform B
Class: hydrolase
Keywords: (beta/alpha)8-barrel, homodimer, family 20 glycosidase
Deposited on 2003-01-16, released 2003-04-08
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-hexosaminidase beta chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1noua1, d1noua2
  • Chain 'B':
    Compound: beta-hexosaminidase beta chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1noub1, d1noub2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nouA (A:)
    akpgpalwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfy
    kwhhepaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgal
    rgletfsqlvyqdsygtftinestiidsprfshrgilidtsrhylpvkiilktldamafn
    kfnvlhwhivddqsfpyqsitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpef
    dtpghtlswgkgqkdlltpcysrqnkldsfgpinptlnttysflttffkeisevfpdqfi
    hlggdevefkcwesnpkiqdfmrqkgfgtdfkklesfyiqkvldiiatinkgsivwqevf
    ddkaklapgtivevwkdsaypeelsrvtasgfpvilsapwyldlisygqdwrkyykvepl
    dfggtqkqkqlfiggeaclwgeyvdatnltprlwprasavgerlwsskdvrdmddaydrl
    trhrcrmvergiaaqplyagycnhenm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nouA (A:)
    alwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqqll
    vsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtft
    inestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqs
    itfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltp
    cysldsfgpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmr
    qkgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypee
    lsrvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgey
    vdatnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nouB (B:)
    akpgpalwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfy
    kwhhepaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgal
    rgletfsqlvyqdsygtftinestiidsprfshrgilidtsrhylpvkiilktldamafn
    kfnvlhwhivddqsfpyqsitfpelsnkgsyslshvytpndvrmvieyarlrgirvlpef
    dtpghtlswgkgqkdlltpcysrqnkldsfgpinptlnttysflttffkeisevfpdqfi
    hlggdevefkcwesnpkiqdfmrqkgfgtdfkklesfyiqkvldiiatinkgsivwqevf
    ddkaklapgtivevwkdsaypeelsrvtasgfpvilsapwyldlisygqdwrkyykvepl
    dfggtqkqkqlfiggeaclwgeyvdatnltprlwprasavgerlwsskdvrdmddaydrl
    trhrcrmvergiaaqplyagycnhenm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nouB (B:)
    alwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqqll
    vsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtft
    inestiidsprfshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqs
    itfpelsnkgsyslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltp
    cysldsfgpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmr
    qkgfgtdfkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypee
    lsrvtasgfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgey
    vdatnltprlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn