PDB entry 1nor

View 1nor on RCSB PDB site
Description: two-dimensional 1h-nmr study of the spatial structure of neurotoxin II from naja oxiana
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1993-04-05, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neurotoxin II
    Species: Naja oxiana [TaxId:8657]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nora_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1norA (A:)
    lechnqqssqppttktcsgetncykkwwsdhrgtiiergcgcpkvkpgvnlnccrtdrcn
    n