PDB entry 1noo

View 1noo on RCSB PDB site
Description: cytochrome p450-cam complexed with 5-exo-hydroxycamphor
Class: oxidoreductase (oxygenase)
Keywords: monooxygenase, oxidoreductase (oxygenase)
Deposited on 1995-12-02, released 1996-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nooa_
  • Heterogens: HEM, CAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nooA (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nooA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav