PDB entry 1non

View 1non on RCSB PDB site
Description: PyrR, the regulator of the pyrimidine biosynthetic operon in Bacillus caldolyticus
Class: transcription, transferase
Keywords: transcription regulation; attenuation protein; RNA-binding protein; pyrimidine biosynthesis; transferase; prtase; uracil phosphoribosyltransferase; bifunctional enzyme, transcription, transferase
Deposited on 2003-01-16, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PyrR bifunctional protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Gene: PYRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nona_
  • Chain 'B':
    Compound: PyrR bifunctional protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Gene: PYRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nonb_
  • Chain 'C':
    Compound: PyrR bifunctional protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Gene: PYRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nonc_
  • Chain 'D':
    Compound: PyrR bifunctional protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Gene: PYRR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nond_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nonA (A:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
    mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nonA (A:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
    hrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nonB (B:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
    mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nonB (B:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
    hrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nonC (C:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
    mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nonC (C:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
    hrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nonD (D:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
    mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nonD (D:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
    hrelpiradfvgknvptsrselivvelsevdgidqvsihek