PDB entry 1nol

View 1nol on RCSB PDB site
Description: oxygenated hemocyanin (subunit type II)
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1995-10-17, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.181
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemocyanin (subunit type II)
    Species: Limulus polyphemus [TaxId:6850]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04253 (0-627)
      • conflict (8)
    Domains in SCOPe 2.07: d1nola1, d1nola2, d1nola3
  • Heterogens: CU, CA, NO3, PER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nolA (A:)
    tlhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhl
    yevfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfi
    psaaineafkkahvrpefdespilvdvqdtgnildpeyrlayyredvginahhwhwhlvy
    pstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphl
    thvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhg
    tdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpif
    ynwhrfidnifheykntlkpydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhg
    inpgnarsikaryyhldhepfsyavnvqnnsasdkhatvriflapkydelgneikadelr
    rtaieldkfktdlhpgkntvvrhsldssvtlshqptfedllhgvglnehkseycscgwps
    hllvpkgnikgmeyhlfvmltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpf
    drpihtehisdfltnnmfikdikikfhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nolA (A:)
    tlhdkqirichlfeqlssatvhsdrlknvgklqpgaifscfhpdhleearhlyevfweag
    dfndfieiakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfipsaainea
    fkkahdespilvdvqdtgnildpeyrlayyredvginahhwhwhlvypstwnpkyfgkkk
    drkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphlthvasgkyysprp
    dglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhgtdilgalvessye
    svnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpifynwhrfidnifhe
    ykntlkpydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikary
    yhldhepfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdl
    hpgkntvvrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlf
    vmltdwdkdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikd
    ikikfhe