PDB entry 1noi

View 1noi on RCSB PDB site
Description: complex of glycogen phosphorylase with a transition state analogue nojirimycin tetrazole and phosphate in the t and r states
Class: glycogen phosphorylase
Keywords: glycogen phosphorylase, transferase, glycosyltransferase
Deposited on 1996-03-12, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.171
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycogen phosphorylase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
      • conflict (608)
    Domains in SCOPe 2.07: d1noia_
  • Chain 'B':
    Compound: glycogen phosphorylase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
      • conflict (608)
    Domains in SCOPe 2.07: d1noib_
  • Chain 'C':
    Compound: glycogen phosphorylase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
      • conflict (608)
    Domains in SCOPe 2.07: d1noic_
  • Chain 'D':
    Compound: glycogen phosphorylase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
      • conflict (608)
    Domains in SCOPe 2.07: d1noid_
  • Heterogens: PO4, PLP, NTZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1noiA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkpapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1noiA (A:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndfnlkdfnvggyiqavldrnlaenisrvlypegkelrlkqeyfvvaatlqdiirrfkss
    kfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcay
    tnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveeg
    avkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvl
    cnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereyk
    vhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkpapgyh
    makmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteas
    gtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydr
    ipelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknp
    rewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1noiB (B:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkpapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1noiB (B:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndfnlkdfnvggyiqavldrnlaenisrvlypegkelrlkqeyfvvaatlqdiirrfkss
    kfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcay
    tnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveeg
    avkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvl
    cnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereyk
    vhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkpapgyh
    makmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteas
    gtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydr
    ipelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknp
    rewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1noiC (C:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkpapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1noiC (C:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndfnlkdfnvggyiqavldrnlaenisrvlypegkelrlkqeyfvvaatlqdiirrfkss
    kfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcay
    tnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveeg
    avkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvl
    cnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereyk
    vhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkpapgyh
    makmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteas
    gtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydr
    ipelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknp
    rewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1noiD (D:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkpapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1noiD (D:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndfnlkdfnvggyiqavldrnlaenisrvlypegkelrlkqeyfvvaatlqdiirrfkss
    kfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcay
    tnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveeg
    avkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvl
    cnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereyk
    vhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkpapgyh
    makmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteas
    gtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydr
    ipelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknp
    rewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapd