PDB entry 1nof

View 1nof on RCSB PDB site
Description: the first crystallographic structure of a xylanase from glycosyl hydrolase family 5: implications for catalysis
Class: hydrolase
Keywords: xylanase, glycohydrolase family 5, carbohydrate-binding module, catalytic domain, hydrolase
Deposited on 2003-01-16, released 2003-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Erwinia chrysanthemi [TaxId:556]
    Gene: xynA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nofa1, d1nofa2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nofA (A:)
    dtvkidanvnyqiiqgfggmsgvgwindltteqintaygsgvgqiglsimrvridpdssk
    wniqlpsarqavslgakimatpwsppaymksnnslinggrllpanysaytshlldfskym
    qtngaplyaisiqnepdwkpdyescewsgdefksylksqgskfgslkvivaeslgfnpal
    tdpvlkdsdaskyvsiigghlygttpkpyplaqnagkqlwmtehyvdskqsannwtsaie
    vgtelnasmvsnysayvwwyirrsyglltedgkvskrgyvmsqyarfvrpgalriqaten
    pqsnvhltaykntdgkmvivavntndsdqmlslnisnanvtkfekystsaslnveyggss
    qvdssgkatvwlnplsvttfvsk