PDB entry 1noe

View 1noe on RCSB PDB site
Description: nmr study of reduced high potential iron sulfur protein
Deposited on 1996-01-07, released 1996-06-10
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-01, with a file datestamp of 1999-08-31.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1noe__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1noe_ (-)
  asapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatde
  wkgcqlfpgklinvngwsaswtlkag