PDB entry 1noc

View 1noc on RCSB PDB site
Description: murine inducible nitric oxide synthase oxygenase domain (delta 114) complexed with type I e. coli chloramphenicol acetyl transferase and imidazole
Class: complex (oxidoreductase/transferase)
Keywords: nitric oxide, l-arginine monooxygenase, heme, imidazole, nos, no, cat, complex (oxidoreductase/transferase)
Deposited on 1997-09-28, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inducible nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1noca_
  • Chain 'B':
    Compound: type 1 chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nocb_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nocA (A:)
    npksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyq
    ltldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngni
    rsaitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkpryg
    rfdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevg
    glefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinv
    avlhsfqkqnvtimdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqem
    lnyvlspfyyyqiepwkthiwqnehhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nocA (A:)
    pksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyql
    tldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnir
    saitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygr
    fdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgg
    lefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinva
    vlhsfqkqnvtimdhhtasesfmkhmqneyrarlvppvsgsitpvfhqemlnyvlspfyy
    yqiepwkthiwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nocB (B:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nocB (B:)
    itgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihila
    rlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdv
    acygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvl
    mplaiqvhhavcdgfhvgrmlnelqqycdewqg