PDB entry 1no8

View 1no8 on RCSB PDB site
Description: solution structure of the nuclear factor aly rbd domain
Class: RNA binding protein
Keywords: RBD, ALY, REF1-I, BEF, mRNA EXPORT FACTOR, RNA BINDING PROTEIN
Deposited on 2003-01-15, released 2003-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aly
    Species: Mus musculus [TaxId:10090]
    Gene: ALY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1no8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1no8A (A:)
    srpkqlpdkwqhdlfdsgfgggagvetggkllvsnldfgvsdadiqelfaefgtlkkaav
    hydrsgrslgtadvhferkadalkamkqyngvpldgrpmniqlvts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1no8A (A:)
    gkllvsnldfgvsdadiqelfaefgtlkkaavhydrsgrslgtadvhferkadalkamkq
    yngvpldgrpmniqlvts