PDB entry 1no5

View 1no5 on RCSB PDB site
Description: Structure of HI0073 from Haemophilus influenzae, the nucleotide binding domain of the HI0073/HI0074 two protein nucleotidyl transferase.
Class: structural genomics, unknown function
Keywords: HI0073, HI0074, structural genomics, nucleotidyl transferase, Structure 2 Function Project, S2F, UNKNOWN FUNCTION
Deposited on 2003-01-15, released 2004-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein HI0073
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0073
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1no5a_
  • Chain 'B':
    Compound: Hypothetical protein HI0073
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0073
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1no5b_
  • Heterogens: ZN, SO4, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1no5A (A:)
mtsfaqldikseelaivktilqqlvpdytvwafgsrvkgkakkysdldlaiiseepldfl
ardrlkeafsesdlpwrvdlldwattsedfreiirkvyvviqekektvekptal

    Sequence, based on observed residues (ATOM records): (download) 
    >1no5A (A:)
qldikseelaivktilqqlvpdytvwafgsrvkgkakkysdldlaiiseepldflardrl
keafsesdlpwrvdlldwattsedfreiirkvyvviqeke

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1no5B (B:)
mtsfaqldikseelaivktilqqlvpdytvwafgsrvkgkakkysdldlaiiseepldfl
ardrlkeafsesdlpwrvdlldwattsedfreiirkvyvviqekektvekptal

    Sequence, based on observed residues (ATOM records): (download) 
    >1no5B (B:)
faqldikseelaivktilqqlvpdytvwafgsrvkgkakkysdldlaiiseepldflard
rlkeafsesdlpwrvdlldwattsedfreiirkvyvviqeke