PDB entry 1no3

View 1no3 on RCSB PDB site
Description: refined structure of soybean lipoxygenase-3 with 4-nitrocatechol at 2.15 angstrom resolution
Class: oxidoreductase
Keywords: lipoxygenase, 4-nitrocatechol, iron, oxidoreductase
Deposited on 2003-01-15, released 2003-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoxygenase-3
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1no3a1, d1no3a2
  • Heterogens: FE, 4NC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1no3A (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1no3A (A:)
    hrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisat
    kadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqteff
    lvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhn
    lrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkd
    pnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfde
    vhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefar
    emlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlfl
    ldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvf
    lpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykl
    lhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlik
    rgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqa
    cwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnr
    ptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylger
    dnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegl
    tfrgipnsisi