PDB entry 1nnx

View 1nnx on RCSB PDB site
Description: Structure of the hypothetical protein ygiW from E. coli.
Class: structural genomics, unknown function
Keywords: ygiW, Structural Genomics, hypothetical protein, OB-fold, Structure 2 Function Project, S2F, UNKNOWN FUNCTION
Deposited on 2003-01-14, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ygiW
    Species: Escherichia coli [TaxId:562]
    Gene: YGIW
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nnxa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nnxA (A:)
    eqggfsgpsatqsqaggfqgpngsvttvesakslrddtwvtlrgniverisddlyvfkda
    sgtinvdidhkrwngvtvtpkdtveiqgevdkdwnsveidvkqirkvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nnxA (A:)
    qggfsgpsgsvttvesakslrddtwvtlrgniverisddlyvfkdasgtinvdidhkrwn
    gvtvtpkdtveiqgevdkdwnsveidvkqirkv