PDB entry 1nnv

View 1nnv on RCSB PDB site
Description: The Solution structure of HI1450
Class: unknown function
Keywords: HYPOTHETICAL PROTEIN, Structure 2 Function Project, S2F, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2003-01-14, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein HI1450
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nnva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1nnvA (A:)
gshmtteikkldpdtaidiaydiflemagenldpadillfnlqfeerggvefvetaddwe
eeigvlidpeeyaevwvglvneqdemddvfakflishreedrefhviwkk

    Sequence, based on observed residues (ATOM records): (download) 
    >1nnvA (A:)
mtteikkldpdtaidiaydiflemagenldpadillfnlqfeerggvefvetaddweeei
gvlidpeeyaevwvglvneqdemddvfakflishreedrefhviwkk