PDB entry 1nnu

View 1nnu on RCSB PDB site
Description: Crystal Structure Analysis of Plasmodium falciparum enoyl-acyl-carrier-protein reductase with Triclosan Analog
Class: oxidoreductase
Keywords: rossmann fold, nadh, short chain dehydrogenase reductase, OXIDOREDUCTASE
Deposited on 2003-01-14, released 2003-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nnu.1
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nnu.2
  • Chain 'C':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nnu.1
  • Chain 'D':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nnu.2
  • Heterogens: NAD, TCT

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nnuA (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraataink
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nnuB (B:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraataink
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nnuC (C:)
    ytfidyaieysekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nnuD (D:)
    ytfidyaieysekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd