PDB entry 1nnt

View 1nnt on RCSB PDB site
Description: structural evidence for a ph-sensitive di-lysine trigger in the hen ovotransferrin n-lobe: implications for transferrin iron release
Class: iron transport protein
Keywords: iron transport protein
Deposited on 1993-09-15, released 1994-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.16
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovotransferrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1nnta_
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nntA (A:)
    svirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisldggqa
    feaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsag
    wnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkcar
    napysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcnw
    arvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkdsa
    imlkrvpslmdsqlylgfeyysaiqsmr