PDB entry 1nnr

View 1nnr on RCSB PDB site
Description: Crystal structure of a probable fosfomycin resistance protein (PA1129) from Pseudomonas aeruginosa with sulfate present in the active site
Class: transferase
Keywords: potassium binding loop, manganese binding, transferase
Deposited on 2003-01-14, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable fosfomycin resistance protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1129
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nnra_
  • Chain 'B':
    Compound: probable fosfomycin resistance protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1129
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nnrb_
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nnrA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nnrA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nnrB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nnrB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa