PDB entry 1nnq

View 1nnq on RCSB PDB site
Description: rubrerythrin from Pyrococcus furiosus Pfu-1210814
Class: Structural Genomics, Unknown Function
Keywords: Rubrerythrin, Pyrococcus furiosus, Structural genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, Unknown Function
Deposited on 2003-01-14, released 2004-03-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1nnqa1, d1nnqa2
  • Chain 'B':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1nnqb1, d1nnqb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nnqA (A:)
    mvvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhf
    ialgklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihael
    yrkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nnqA (A:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nnqB (B:)
    mvvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhf
    ialgklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihael
    yrkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nnqB (B:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe