PDB entry 1nnj

View 1nnj on RCSB PDB site
Description: Crystal structure Complex between the Lactococcus lactis Fpg and an abasic site containing DNA
Class: hydrolase
Keywords: DNA repair, Fpg, MutM, abasic site
Deposited on 2003-01-14, released 2003-02-11
The last revision prior to the SCOP 1.75 freeze date was dated 2003-02-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Lactococcus lactis
    Gene: mutM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42371 (0-270)
      • engineered (0)
    Domains in SCOP 1.75: d1nnja1, d1nnja2, d1nnja3
  • Chain 'D':
    Compound: 5'-d(*cp*tp*cp*tp*tp*tp*(pdi)p*tp*tp*tp*cp*tp*cp*g)-3'
  • Chain 'E':
    Compound: 5'-d(*gp*cp*gp*ap*gp*ap*ap*ap*cp*ap*ap*ap*gp*a)-3'
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nnjA (A:)
    gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvygk
    tgekcsrcgaeiqkikvagrgthfcpvcqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nnjA (A:)
    gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggssialgstgkmqnelqvygktgek
    csrcgaeiqkikvagrgthfcpvcqqk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.