PDB entry 1nni

View 1nni on RCSB PDB site
Description: Azobenzene Reductase from Bacillus subtilis
Class: oxidoreductase
Keywords: azobenzene reductase, azoreductase, structural genomics, flavoproteins, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2003-01-13, released 2003-07-29
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: hypothetical protein yhda
    Species: Bacillus subtilis
    Gene: yhdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07529 (0-End)
      • cloning artifact (0)
      • cloning artifact (2)
      • cloning artifact (77)
      • cloning artifact (117)
      • cloning artifact (121)
      • cloning artifact (164)
    Domains in SCOP 1.73: d1nni1_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download) 
    >1nni1 (1:)
mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagnpgv

    Sequence, based on observed residues (ATOM records): (download) 
    >1nni1 (1:)
mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagn