PDB entry 1nni

View 1nni on RCSB PDB site
Description: Azobenzene Reductase from Bacillus subtilis
Deposited on 2003-01-13, released 2003-07-29
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.65: d1nni1_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1nni1 (1:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagnpgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nni1 (1:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagn