PDB entry 1nnh

View 1nnh on RCSB PDB site
Description: Hypothetical protein from Pyrococcus furiosus Pfu-1801964
Class: Structural Genomics, Unknown function
Keywords: Pyrococcus furiosus, asparaginyl-tRNA synthetase, structural genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, Unknown function
Deposited on 2003-01-13, released 2004-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: asparaginyl-tRNA synthetase-related peptide
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nnha_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nnhA (A:)
    mnaveiisreisptldiqtkileymtdffvkegfkwllpviispitdplwpdpagegmep
    aeveiygvkmrlthsmilhkqlaiamglkkifvlspnirlesrqkddgrhayeftqldfe
    verakmedimrlierlvyglfrkaeewtgrefpktkrfevfeysevleefgsdekasqem
    eepfwiiniprefydrevdgfwrnydlilpygygevasggereweyekivakirkaglne
    dsfrpyleiakagklkpsagagigverlvrfivgakhiaevqpfpripgipavi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nnhA (A:)
    naveiisreisptldiqtkileymtdffvkegfkwllpviispitdplwpdpagegmepa
    eveiygvkmrlthsmilhkqlaiamglkkifvlspnirlesrqkddgrhayeftqldfev
    erakmedimrlierlvyglfrkaeewtgrefpktkrfevfeysevleefgsdekasqeme
    epfwiiniprefydrevdgfwrnydlilpygygevasggereweyekivakirkaglned
    sfrpyleiakagklkpsagagigverlvrfivgakhiaevqpfpripgipavi