PDB entry 1nnc

View 1nnc on RCSB PDB site
Description: influenza virus neuraminidase subtype n9 (tern) complexed with 4-guanidino-neu5ac2en inhibitor
Class: hydrolase (o-glucosyl)
Keywords: neuraminidase, sialidase, hydrolase (o-glucosyl)
Deposited on 1995-03-15, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.156
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuraminidase n9
    Species: Influenza A virus (A/tern/Australia/G70C/1975(H11N9)) [TaxId:384509]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nnca_
  • Heterogens: MAN, NAG, CA, ZMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nncA (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl