PDB entry 1nnb

View 1nnb on RCSB PDB site
Description: three-dimensional structure of influenza a n9 neuraminidase and its complex with the inhibitor 2-deoxy 2,3-dehydro-n-acetyl neuraminic acid
Deposited on 1993-03-08, released 1994-04-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.179
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1nnb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nnb_ (-)
    dfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttirg
    khsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnna
    saviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkegk
    ilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicspv
    ltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpna
    ltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwtsn
    sivsmcssteflgqwdwpdgakieyfl