PDB entry 1nna

View 1nna on RCSB PDB site
Description: three-dimensional structure of influenza a n9 neuraminidase and its complex with the inhibitor 2-deoxy 2,3-dehydro-n-acetyl neuraminic acid
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1993-03-08, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nnaa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nnaA (A:)
    dfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttirg
    khsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnna
    saviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkegk
    ilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicspv
    ltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpna
    ltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwtsn
    sivsmcssteflgqwdwpdgakieyfl