PDB entry 1nn7

View 1nn7 on RCSB PDB site
Description: crystal structure of the tetramerization domain of the shal voltage- gated potassium channel
Deposited on 2003-01-13, released 2003-07-15
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.23
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1nn7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nn7A (A:)
  livlnvsgtrfqtwqdtlerypdtllgsserdffyhpetqqyffdrdpdifrhilnfyrt
  gklhyprhecisaydeelaffglipeiigdccyeeykdrrrenae