PDB entry 1nn7

View 1nn7 on RCSB PDB site
Description: Crystal Structure Of The Tetramerization Domain Of The Shal Voltage-Gated Potassium Channel
Class: membrane protein
Keywords: T1, teteramerization domain, voltage gated potassium channel, Kv4.2, shal, MEMBRANE PROTEIN
Deposited on 2003-01-13, released 2003-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potassium channel Kv4.2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcnd2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nn7a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nn7A (A:)
livlnvsgtrfqtwqdtlerypdtllgsserdffyhpetqqyffdrdpdifrhilnfyrt
gklhyprhecisaydeelaffglipeiigdccyeeykdrrrenae